PDB entry 3k7j

View 3k7j on RCSB PDB site
Description: Crystal structure of the D100E mutant of the Indian Hedgehog N-terminal signalling domain
Class: signaling protein
Keywords: alpha+beta sandwich, Autocatalytic cleavage, Cell membrane, Developmental protein, Disease mutation, Glycoprotein, Hydrolase, Lipoprotein, Membrane, Palmitate, Protease, Secreted, SIGNALING PROTEIN
Deposited on 2009-10-13, released 2011-01-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Indian hedgehog protein
    Species: Homo sapiens [TaxId:9606]
    Gene: IHH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14623
      • engineered mutation (84)
    Domains in SCOPe 2.03: d3k7jb_
  • Heterogens: ZN, SO4, CO3, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3k7jB (B:)
mrgshhhhhhgscgpgrvvgsrrrpprklvplaykqfspnvpektlgasgryegkiarss
erfkeltpnynpdiifkdeentgaerlmtqrckdrlnslaisvmnqwpgvklrvtegwde
dghhseeslhyegravdittsdrdrnkygllarlaveagfdwvyyeskahvhcsvksehs
aaaktgg

    Sequence, based on observed residues (ATOM records): (download) 
    >3k7jB (B:)
prklvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkaerlmtqr
ckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrnkygll
arlaveagfdwvyyeskahvhcsvks