Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily) 2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array |
Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) |
Family e.22.1.0: automated matches [191565] (1 protein) not a true family |
Protein automated matches [190982] (7 species) not a true protein |
Species Ralstonia eutropha [TaxId:264198] [232657] (1 PDB entry) |
Domain d3jzdd_: 3jzd D: [232661] automated match to d3iv7a_ complexed with ca, cl, gol, nad, p6g, peg, pg4, pge |
PDB Entry: 3jzd (more details), 2.1 Å
SCOPe Domain Sequences for d3jzdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jzdd_ e.22.1.0 (D:) automated matches {Ralstonia eutropha [TaxId: 264198]} sqpfiyeahaarvvfgagsssqvaaeverlgakralvlctpnqqaeaeriadllgplsag vyagavmhvpiesardatarareagadcavavgggsttglgkaialetgmpivaipttya gsevtpvyglteagtkrtgrdprvlprtviydpaltvglprglsvtsalnaiahaaegly ardanpvmslmaeegiralaagipavfndpadldarsqclygawlcgtvlggvgmalhhk lchtlggsfnlphaethtivlphalaynaaavpeamarirratgageqsaaatlfdlaqr hgapvalrdigmreedldraadialaspywnprpierepirallqaayegvrpd
Timeline for d3jzdd_: