Lineage for d3jzdd_ (3jzd D:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953870Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 1953871Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 1953939Family e.22.1.0: automated matches [191565] (1 protein)
    not a true family
  6. 1953940Protein automated matches [190982] (7 species)
    not a true protein
  7. 1953968Species Ralstonia eutropha [TaxId:264198] [232657] (1 PDB entry)
  8. 1953972Domain d3jzdd_: 3jzd D: [232661]
    automated match to d3iv7a_
    complexed with ca, cl, gol, nad, p6g, peg, pg4, pge

Details for d3jzdd_

PDB Entry: 3jzd (more details), 2.1 Å

PDB Description: crystal structure of putative alcohol dehedrogenase (yp_298327.1) from ralstonia eutropha jmp134 at 2.10 a resolution
PDB Compounds: (D:) Iron-containing alcohol dehydrogenase

SCOPe Domain Sequences for d3jzdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jzdd_ e.22.1.0 (D:) automated matches {Ralstonia eutropha [TaxId: 264198]}
sqpfiyeahaarvvfgagsssqvaaeverlgakralvlctpnqqaeaeriadllgplsag
vyagavmhvpiesardatarareagadcavavgggsttglgkaialetgmpivaipttya
gsevtpvyglteagtkrtgrdprvlprtviydpaltvglprglsvtsalnaiahaaegly
ardanpvmslmaeegiralaagipavfndpadldarsqclygawlcgtvlggvgmalhhk
lchtlggsfnlphaethtivlphalaynaaavpeamarirratgageqsaaatlfdlaqr
hgapvalrdigmreedldraadialaspywnprpierepirallqaayegvrpd

SCOPe Domain Coordinates for d3jzdd_:

Click to download the PDB-style file with coordinates for d3jzdd_.
(The format of our PDB-style files is described here.)

Timeline for d3jzdd_: