Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Jannaschia sp. [TaxId:290400] [232554] (1 PDB entry) |
Domain d3i6tc1: 3i6t C:6-130 [232560] Other proteins in same PDB: d3i6ta2, d3i6tb2, d3i6tc2 automated match to d2p8ba1 complexed with k, mg |
PDB Entry: 3i6t (more details), 1.9 Å
SCOPe Domain Sequences for d3i6tc1:
Sequence, based on SEQRES records: (download)
>d3i6tc1 d.54.1.0 (C:6-130) automated matches {Jannaschia sp. [TaxId: 290400]} qiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwvvftgsve atyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvw allgg
>d3i6tc1 d.54.1.0 (C:6-130) automated matches {Jannaschia sp. [TaxId: 290400]} qiiagftlwhlslpvtavevvvlrlqadsgavgygeaspwvvftgsveatyaaldrylrp lvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvwallgg
Timeline for d3i6tc1: