Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Jannaschia sp. [TaxId:290400] [232556] (1 PDB entry) |
Domain d3i6ta2: 3i6t A:131-369 [232557] Other proteins in same PDB: d3i6ta1, d3i6tb1, d3i6tc1, d3i6td1 automated match to d2p8ba2 complexed with k, mg |
PDB Entry: 3i6t (more details), 1.9 Å
SCOPe Domain Sequences for d3i6ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i6ta2 c.1.11.0 (A:131-369) automated matches {Jannaschia sp. [TaxId: 290400]} rcrdriplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdmmrlerlradfpa fdirvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarirdavdvplladesi fgpedmaehpeiadgvsikimksggltraqtvarmaaarglsayggdmfeaglahlagah miaatpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvdvdedalarfav
Timeline for d3i6ta2: