SCOPe 2.08: Domain d3h90c1: 3h90 C:8-208

Lineage for d3h90c1 (3h90 C:8-208)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.59: Cation efflux protein transmembrane domain-like [161110] (1 superfamily)
   6 transmembrane helices, bundle

4. Superfamily f.59.1: Cation efflux protein transmembrane domain-like [161111] (1 family)

5. Family f.59.1.1: Cation efflux protein transmembrane domain-like [161112] (2 proteins)
   N-terminal part of Pfam PF01545

6. Protein automated matches [232436] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [232437] (1 PDB entry)

8. Domain d3h90c1: 3h90 C:8-208 [232447]
   Other proteins in same PDB: d3h90a2, d3h90b2, d3h90c2, d3h90d2
   automated match to d2qfia2
   complexed with hg, zn

Details for d3h90c1

PDB Entry: 3h90, 2.9 Å

PDB Description: Structural basis for the autoregulation of the zinc transporter YiiP

PDB Compounds: (C:) Ferrous-iron efflux pump fieF

SCOPe Domain Sequences for d3h90c1:

Sequence; same for both SEQRES and ATOM records:

>d3h90c1 f.59.1.1 (C:8-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvsraaiaatamasllllikifawwytgsvsilaalvdslvdigasltnllvvryslqpa
ddnhsfghgkaeslaalaqsmfisgsalflfltgiqhlisptpmtdpgvgvivtivalic
tiilvsfqrwvvrrtqsqavradmlhyqsdvmmngaillalglswygwhradalfalgig
iyilysalrmgyeavqslldr

Timeline for d3h90c1:

• d3h90c1 first appeared in SCOPe 2.03
  
• d3h90c1 appears in SCOPe 2.07