Class a: All alpha proteins [46456] (289 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein automated matches [190369] (6 species) not a true protein |
Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232370] (2 PDB entries) |
Domain d3h4ea1: 3h4e A:1-147 [232376] Other proteins in same PDB: d3h4ea2, d3h4eb2, d3h4ec2, d3h4ed2, d3h4ee2, d3h4ef2, d3h4eg2, d3h4eh2, d3h4ei2, d3h4ej2, d3h4ek2, d3h4el2 automated match to d1e6jp2 |
PDB Entry: 3h4e (more details), 2.7 Å
SCOPe Domain Sequences for d3h4ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h4ea1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]} pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmysp
Timeline for d3h4ea1: