Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) |
Protein DNA polymerase iota [111295] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111296] (19 PDB entries) Uniprot Q9UNA4 |
Domain d3gv7b1: 3gv7 B:26-299 [232317] Other proteins in same PDB: d3gv7b2 automated match to d2dpia2 protein/DNA complex; complexed with mg, ttp |
PDB Entry: 3gv7 (more details), 2.2 Å
SCOPe Domain Sequences for d3gv7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gv7b1 e.8.1.7 (B:26-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} ssrvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdak ekcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqs delsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkll aklvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfs pkilekelgisvaqriqklsfgednspvilsgpp
Timeline for d3gv7b1: