Lineage for d3gmla2 (3gml A:186-281)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766609Domain d3gmla2: 3gml A:186-281 [232294]
    Other proteins in same PDB: d3gmla1, d3gmlb_
    automated match to d3hujc2
    complexed with c6q, edo, nag, plm

Details for d3gmla2

PDB Entry: 3gml (more details), 1.7 Å

PDB Description: structure of mouse cd1d in complex with c6ph
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3gmla2:

Sequence, based on SEQRES records: (download)

>d3gmla2 b.1.1.0 (A:186-281) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilywgs

Sequence, based on observed residues (ATOM records): (download)

>d3gmla2 b.1.1.0 (A:186-281) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlsshrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatld
veageeaglacrvkhsslggqdiilywgs

SCOPe Domain Coordinates for d3gmla2:

Click to download the PDB-style file with coordinates for d3gmla2.
(The format of our PDB-style files is described here.)

Timeline for d3gmla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gmla1
View in 3D
Domains from other chains:
(mouse over for more information)
d3gmlb_