![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
![]() | Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
![]() | Protein automated matches [232090] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries) |
![]() | Domain d3etrm2: 3etr M:415-528 [232093] Other proteins in same PDB: d3etra1, d3etra2, d3etrb1, d3etrc1, d3etrc2, d3etrl1, d3etrl2, d3etrm1, d3etrn1, d3etrn2 automated match to d1v97a4 complexed with ca, fad, fes, luz, mos, mte |
PDB Entry: 3etr (more details), 2.2 Å
SCOPe Domain Sequences for d3etrm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etrm2 d.87.2.0 (M:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3etrm2: