SCOPe 2.06: Domain d3eqvb1: 3eqv B:66-237

Lineage for d3eqvb1 (3eqv B:66-237)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (10 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [225540] (2 PDB entries)

8. Domain d3eqvb1: 3eqv B:66-237 [232066]
   Other proteins in same PDB: d3eqva2, d3eqvb2
   automated match to d4kqoa1
   complexed with gol, so4; mutant

Details for d3eqvb1

PDB Entry: 3eqv, 2.4 Å

PDB Description: crystal structure of penicillin-binding protein 2 from neisseria gonorrhoeae containing four mutations associated with penicillin resistance

PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d3eqvb1:

Sequence, based on SEQRES records:

>d3eqvb1 d.175.1.0 (B:66-237) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
vrtqalpatrgtvsdrngavlalsapteslfavpkdmkempsaaqlerlselvdvpvdvl
rnkleqkgksfiwikrqldpkvaeevkalglenfvfekelkrhypmgnlfahvigftdid
gkgqeglelsledslygedgaevvlrdrqgnivdsldsprnkapqngkdiil

Sequence, based on observed residues (ATOM records):

>d3eqvb1 d.175.1.0 (B:66-237) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
vrtqalpatrgtvsdrngavlalsaptelkrhypmgnlfahvigftdidgkgqeglelsl
edslygedgaevvlrdnivdsldsprnkapqngkdiil

Timeline for d3eqvb1:

• d3eqvb1 first appeared in SCOPe 2.03
  
• d3eqvb1 appears in SCOPe 2.05
  
• d3eqvb1 appears in SCOPe 2.07
  
• d3eqvb1 appears in the current release, SCOPe 2.08