SCOPe 2.05: Domain d2zi8a1: 2zi8 A:1-132

Lineage for d2zi8a1 (2zi8 A:1-132)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (18 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [231709] (2 PDB entries)

8. Domain d2zi8a1: 2zi8 A:1-132 [231710]
   automated match to d2wl3b1
   complexed with fe2, sdt

Details for d2zi8a1

PDB Entry: 2zi8, 2.2 Å

PDB Description: crystal structure of the hsac extradiol dioxygenase from m. tuberculosis in complex with 3,4-dihydroxy-9,10-seconandrost-1,3, 5(10)-triene-9,17-dione (dhsa)

PDB Compounds: (A:) probable biphenyl-2,3-diol 1,2-dioxygenase bphc

SCOPe Domain Sequences for d2zi8a1:

Sequence; same for both SEQRES and ATOM records:

>d2zi8a1 d.32.1.0 (A:1-132) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msirslgylrieatdmaawreyglkvlgmvegkgapegalylrmddfparlvvvpgehdr
lleagwecanaeglqeirnrldlegtpykeataaeladrrvdemirfadpsgnclevfhg
talehrrvvspy

Timeline for d2zi8a1:

• d2zi8a1 first appeared in SCOPe 2.03
  
• d2zi8a1 appears in SCOPe 2.04
  
• d2zi8a1 appears in SCOPe 2.06
  
• d2zi8a1 appears in the current release, SCOPe 2.08