Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species) |
Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries) Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690 |
Domain d2wlkb1: 2wlk B:11-138 [231443] Other proteins in same PDB: d2wlka2, d2wlka3, d2wlkb2, d2wlkb3 automated match to d1xl4a2 complexed with cl, k, spm |
PDB Entry: 2wlk (more details), 2.8 Å
SCOPe Domain Sequences for d2wlkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wlkb1 f.14.1.1 (B:11-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla cgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasl iyarftrp
Timeline for d2wlkb1: