Lineage for d2wl9b1 (2wl9 B:2-134)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2187139Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2187140Protein automated matches [190239] (20 species)
    not a true protein
  7. 2187256Species Rhodococcus sp. [TaxId:186196] [225962] (2 PDB entries)
  8. 2187259Domain d2wl9b1: 2wl9 B:2-134 [231435]
    automated match to d2wl3a1
    complexed with fe, gol, mbd, mg

Details for d2wl9b1

PDB Entry: 2wl9 (more details), 1.9 Å

PDB Description: crystal structure of catechol 2,3-dioxygenase
PDB Compounds: (B:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d2wl9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wl9b1 d.32.1.0 (B:2-134) automated matches {Rhodococcus sp. [TaxId: 186196]}
akvtelgylglsvsnldawrdyaagimgmqvvddgeddriylrmdrwhhrivlhadgsdd
layigwrvagpveldelaeqlknagipfevasdadaaerrvlglvklhdpggnpteifyg
pqvdtsspfhpgr

SCOPe Domain Coordinates for d2wl9b1:

Click to download the PDB-style file with coordinates for d2wl9b1.
(The format of our PDB-style files is described here.)

Timeline for d2wl9b1: