SCOPe 2.08: Domain d2uvia1: 2uvi A:28-430

Lineage for d2uvia1 (2uvi A:28-430)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Yersinia enterocolitica [TaxId:630] [231285] (4 PDB entries)

8. Domain d2uvia1: 2uvi A:28-430 [231288]
   Other proteins in same PDB: d2uvia2
   automated match to d4ovja_

Details for d2uvia1

PDB Entry: 2uvi, 2.3 Å

PDB Description: structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica in complex with 4,5-unsaturated digalacturonic acid

PDB Compounds: (A:) abc type periplasmic sugar-binding protein

SCOPe Domain Sequences for d2uvia1:

Sequence; same for both SEQRES and ATOM records:

>d2uvia1 c.94.1.0 (A:28-430) automated matches {Yersinia enterocolitica [TaxId: 630]}
vnlrmswwggngrhqvtlkaleefhkqhpninvkaeytgwdghlsrlttqiaggtepdvm
qtnwnwlpifskdgtgfynlfsvkeqldlaqfdpkelqqttvngklngipisvtarifyf
ndatwakagleypktwdellaagkvfkeklgdqyypvvlehqdtlalirsymtqkynipt
ideankkfayspeqwvefftmyktmvdnhvmpstkyyasfgksnmyemkpwingewagty
mwnstitkysdnltkpaklvlgpypmlpgakdaglffkpaqmlsigkstkhpqesamlin
fllnskegvealglergvplsatavtqlrasgvikdedpsvaglnmalelphkmttspyf
ddpqivslfgdaiqyidygqktvqetaeyfnkqgdrilkramr

Timeline for d2uvia1:

• d2uvia1 first appeared in SCOPe 2.03, called d2uvia_
  
• d2uvia1 was called d2uvia_ in SCOPe 2.07