Lineage for d2oqhc2 (2oqh C:123-369)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837806Species Streptomyces coelicolor [TaxId:100226] [231096] (3 PDB entries)
  8. 2837809Domain d2oqhc2: 2oqh C:123-369 [231099]
    Other proteins in same PDB: d2oqha1, d2oqha3, d2oqhb1, d2oqhb3, d2oqhc1, d2oqhc3, d2oqhd1, d2oqhd3
    automated match to d2p8ba2
    complexed with so4

Details for d2oqhc2

PDB Entry: 2oqh (more details), 1.98 Å

PDB Description: crystal structure of an isomerase from streptomyces coelicolor a3(2)
PDB Compounds: (C:) Putative isomerase

SCOPe Domain Sequences for d2oqhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqhc2 c.1.11.0 (C:123-369) automated matches {Streptomyces coelicolor [TaxId: 100226]}
avrdevpitalitradapgatpadlpkamaehavrvveeggfdavklkgttdcagdvail
ravrealpgvnlrvdpnaawsvpdsvragialeeldleyledpcvgiegmaqvkakvrip
lctnmcvvrfedfapamrlnavdvihgdvykwggiaatkalaahcetfglgmnlhsggel
giataahlavvsstpvlsraidsmyylhaddiieplhlengrlrvpsgpglgvsvdedkl
rhyagvn

SCOPe Domain Coordinates for d2oqhc2:

Click to download the PDB-style file with coordinates for d2oqhc2.
(The format of our PDB-style files is described here.)

Timeline for d2oqhc2: