Lineage for d2jlva2 (2jlv A:483-618)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128432Species Dengue virus 4 [TaxId:408688] [230938] (4 PDB entries)
  8. 2128435Domain d2jlva2: 2jlv A:483-618 [230958]
    Other proteins in same PDB: d2jlva1, d2jlva3, d2jlvb1, d2jlvb3
    automated match to d2bhra1
    protein/RNA complex; complexed with anp, cl, gol, mn

Details for d2jlva2

PDB Entry: 2jlv (more details), 2.3 Å

PDB Description: dengue virus 4 ns3 helicase in complex with ssrna and amppnp
PDB Compounds: (A:) serine protease subunit ns3

SCOPe Domain Sequences for d2jlva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jlva2 c.37.1.0 (A:483-618) automated matches {Dengue virus 4 [TaxId: 408688]}
edhahwteakmlldniytpegiiptlfgperektqaidgefrlrgeqrktfvelmrrgdl
pvwlsykvasagisykdrewcftgernnqileenmeveiwtregekkklrpkwldarvya
dpmalkdfkefasgrk

SCOPe Domain Coordinates for d2jlva2:

Click to download the PDB-style file with coordinates for d2jlva2.
(The format of our PDB-style files is described here.)

Timeline for d2jlva2: