SCOPe 2.05: Domain d2i79c_: 2i79 C:

Lineage for d2i79c_ (2i79 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (32 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [225152] (1 PDB entry)

8. Domain d2i79c_: 2i79 C: [230780]
   automated match to d2i79d_
   complexed with aco

Details for d2i79c_

PDB Entry: 2i79, 2.1 Å

PDB Description: The crystal structure of the acetyltransferase of GNAT family from Streptococcus pneumoniae

PDB Compounds: (C:) acetyltransferase, GNAT family

SCOPe Domain Sequences for d2i79c_:

Sequence; same for both SEQRES and ATOM records:

>d2i79c_ d.108.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
meyellireaepkdaaelvaflnrvsletdftsldgdgilltseemeiflnkqassdnqi
tllaflngkiagivnitadqrkrvrhigdlfivigkrywnnglgsllleeaiewaqasgi
lrrlqltvqtrnqaavhlyqkhgfviegsqergayieegkfidvylmgkli

Timeline for d2i79c_:

• d2i79c_ first appeared in SCOPe 2.03
  
• d2i79c_ appears in SCOPe 2.04
  
• d2i79c_ appears in SCOPe 2.06
  
• d2i79c_ appears in the current release, SCOPe 2.08