SCOP 1.61: Domain d1niba1: 1nib A:8-166

Lineage for d1niba1 (1nib A:8-166)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (7 PDB entries)

8. Domain d1niba1: 1nib A:8-166 [23064]

Details for d1niba1

PDB Entry: 1nib, 2.7 Å

PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted

SCOP Domain Sequences for d1niba1:

Sequence; same for both SEQRES and ATOM records:

>d1niba1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d1niba1:

• d1niba1 first appeared (with stable ids) in SCOP 1.55
  
• d1niba1 appears in SCOP 1.59
  
• d1niba1 appears in SCOP 1.63
  
• d1niba1 appears in the current release, SCOPe 2.08