Lineage for d2c9te_ (2c9t E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811015Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)
  8. 1811070Domain d2c9te_: 2c9t E: [230588]
    automated match to d2qc1b_

Details for d2c9te_

PDB Entry: 2c9t (more details), 2.25 Å

PDB Description: crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with alpha-conotoxin imi
PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2c9te_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9te_ b.96.1.0 (E:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2c9te_:

Click to download the PDB-style file with coordinates for d2c9te_.
(The format of our PDB-style files is described here.)

Timeline for d2c9te_: