Lineage for d2bzra1 (2bzr A:21-277)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853345Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2853512Protein automated matches [226926] (3 species)
    not a true protein
  7. 2853583Species Mycobacterium tuberculosis [TaxId:83332] [230567] (1 PDB entry)
  8. 2853584Domain d2bzra1: 2bzr A:21-277 [230568]
    automated match to d2a7sa1

Details for d2bzra1

PDB Entry: 2bzr (more details), 2.2 Å

PDB Description: crystal structure of accd5 (rv3280), an acyl-coa carboxylase beta-subunit from mycobacterium tuberculosis
PDB Compounds: (A:) propionyl-coa carboxylase beta chain 5

SCOPe Domain Sequences for d2bzra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzra1 c.14.1.4 (A:21-277) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldalak
hrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqelai
ktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvyspa
ltdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdafd
yvrellsylppnnstda

SCOPe Domain Coordinates for d2bzra1:

Click to download the PDB-style file with coordinates for d2bzra1.
(The format of our PDB-style files is described here.)

Timeline for d2bzra1: