Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.0: automated matches [227276] (1 protein) not a true family |
Protein automated matches [227084] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [230557] (5 PDB entries) |
Domain d2bznd1: 2bzn D:10-336 [230562] Other proteins in same PDB: d2bzna2, d2bznb2, d2bznc2, d2bznd2, d2bzne2, d2bznf2, d2bzng2, d2bznh2 automated match to d4mjma_ complexed with imp |
PDB Entry: 2bzn (more details), 2.15 Å
SCOPe Domain Sequences for d2bznd1:
Sequence, based on SEQRES records: (download)
>d2bznd1 c.1.5.0 (D:10-336) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldfkdvllrpkrstlksrsevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlck fslftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicld vangysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvcttr kktgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlaghs esggelierdgkkyklfygmssemamkkyaggvaeyrasegktvevpfkgdvehtirdil ggirstctyvgaaklkelsrrttfirv
>d2bznd1 c.1.5.0 (D:10-336) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldfkdvllrpkrstlevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlckfslf tavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicldvang ysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvcttrkktg vgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlaghsesgg elierdgkkyklfygmssemamkkyasegktvevpfkgdvehtirdilggirstctyvga aklkelsrrttfirv
Timeline for d2bznd1: