Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
Protein automated matches [191104] (14 species) not a true protein |
Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries) |
Domain d2boqa_: 2boq A: [230535] automated match to d4fcna_ complexed with ca, cac, hem, mn, zn |
PDB Entry: 2boq (more details), 1.33 Å
SCOPe Domain Sequences for d2boqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2boqa_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]} atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaadkvdps ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl sdveqacaatpfpaltadp
Timeline for d2boqa_: