SCOPe 2.08: Domain d2aejb2: 2aej B:245-335

Lineage for d2aejb2 (2aej B:245-335)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
   Pfam PF02080

6. Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries)

8. Domain d2aejb2: 2aej B:245-335 [230507]
   Other proteins in same PDB: d2aeja1, d2aeja3, d2aejb1
   automated match to d2fy8a2

Details for d2aejb2

PDB Entry: 2aej, 2.1 Å

PDB Description: Crystal Structures of the MthK RCK Domain in no Ca2+ bound form

PDB Compounds: (B:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d2aejb2:

Sequence; same for both SEQRES and ATOM records:

>d2aejb2 d.286.1.1 (B:245-335) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyis

Timeline for d2aejb2:

• d2aejb2 first appeared in SCOPe 2.03
  
• d2aejb2 appears in SCOPe 2.07