Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Quinol oxidase (CyoA) [49542] (1 species) |
Species Escherichia coli [TaxId:562] [49543] (3 PDB entries) |
Domain d1fftg1: 1fft G:118-283 [23026] Other proteins in same PDB: d1ffta_, d1fftb2, d1fftc2, d1fftc3, d1fftf_, d1fftg2, d1ffth2, d1ffth3 complexed with cu, hem, heo |
PDB Entry: 1fft (more details), 3.5 Å
SCOPe Domain Sequences for d1fftg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fftg1 b.6.1.2 (G:118-283) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]} kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfma
Timeline for d1fftg1: