SCOP 1.61: Domain d1fftg1: 1fft G:118-283

Lineage for d1fftg1 (1fft G:118-283)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Quinol oxidase (CyoA) [49542] (1 species)

7. Species Escherichia coli [TaxId:562] [49543] (3 PDB entries)

8. Domain d1fftg1: 1fft G:118-283 [23026]
   Other proteins in same PDB: d1ffta1, d1fftb2, d1fftc1, d1fftf1, d1fftg2, d1ffth1

Details for d1fftg1

PDB Entry: 1fft

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftg1:

Sequence; same for both SEQRES and ATOM records:

>d1fftg1 b.6.1.2 (G:118-283) Quinol oxidase (CyoA) {Escherichia coli}
kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip
rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak
akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfma

Timeline for d1fftg1:

• d1fftg1 first appeared (with stable ids) in SCOP 1.55
  
• d1fftg1 appears in SCOP 1.59
  
• d1fftg1 appears in SCOP 1.63
  
• d1fftg1 appears in the current release, SCOPe 2.08