Lineage for d1fftg2 (1fft G:27-117)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201689Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 201820Protein Ubiquinol oxidase [56888] (1 species)
  7. 201821Species Escherichia coli [TaxId:562] [56889] (1 PDB entry)
  8. 201826Domain d1fftg2: 1fft G:27-117 [43631]
    Other proteins in same PDB: d1fftb1, d1fftg1

Details for d1fftg2

PDB Entry: 1fft (more details)

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftg2 f.2.1.3 (G:27-117) Ubiquinol oxidase {Escherichia coli}
salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
kveavvwtvpiliiiflavltwktthaleps

SCOP Domain Coordinates for d1fftg2:

Click to download the PDB-style file with coordinates for d1fftg2.
(The format of our PDB-style files is described here.)

Timeline for d1fftg2: