Class b: All beta proteins [48724] (177 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (13 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228531] (4 PDB entries) |
Domain d4m78j_: 4m78 J: [229673] automated match to d4m75c_ protein/RNA complex |
PDB Entry: 4m78 (more details), 2.79 Å
SCOPe Domain Sequences for d4m78j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m78j_ b.38.1.0 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelseserr semvfirgdtvtlistp
Timeline for d4m78j_: