![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries) |
![]() | Domain d4c4ea_: 4c4e A: [229416] automated match to d3ceka_ complexed with 1pe, 4t9, 7pe |
PDB Entry: 4c4e (more details), 2.6 Å
SCOPe Domain Sequences for d4c4ea_:
Sequence, based on SEQRES records: (download)
>d4c4ea_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsmsvkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiayl nklqqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmleav htihqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvvkdsqvgtvnymppeai kdmsssrengkskskispksdvwslgcilyymtygktpfqqiinqisklhaiidpnheie fpdipekdlqdvlkcclkrdpkqrisipellahpyvqiq
>d4c4ea_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsmsvkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiayl nklqqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmleav htihqhgivhsdlkpanflivdgmlklidfgianqmqpqvgtvnymppeaikdispksdv wslgcilyymtygktpfqqiinqisklhaiidpnheiefpdipekdlqdvlkcclkrdpk qrisipellahpyvqiq
Timeline for d4c4ea_: