SCOPe 2.08: Domain d4kgxb1: 4kgx B:9-100

Lineage for d4kgxb1 (4kgx B:9-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
   Uniprot P00478

8. Domain d4kgxb1: 4kgx B:9-100 [229288]
   Other proteins in same PDB: d4kgxa1, d4kgxa2, d4kgxb2, d4kgxc1, d4kgxc2, d4kgxd2
   automated match to d2fzcb1
   complexed with ctp, pal, zn

Details for d4kgxb1

PDB Entry: 4kgx, 2.2 Å

PDB Description: the r state structure of e. coli atcase with ctp bound

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4kgxb1:

Sequence; same for both SEQRES and ATOM records:

>d4kgxb1 d.58.2.1 (B:9-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
veaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflse
dqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d4kgxb1:

• d4kgxb1 first appeared in SCOPe 2.03
  
• d4kgxb1 appears in SCOPe 2.07