SCOPe 2.02: Domain d1a4cb_: 1a4c B:

Lineage for d1a4cb_ (1a4c B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)

8. Domain d1a4cb_: 1a4c B: [22914]
   complexed with cu, no3, so4; mutant

Details for d1a4cb_

PDB Entry: 1a4c, 2.45 Å

PDB Description: azurin mutant with met 121 replaced by his, ph 3.5 crystal form, data collected at-180 degrees celsius

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d1a4cb_:

Sequence; same for both SEQRES and ATOM records:

>d1a4cb_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans [TaxId: 32002]}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn

Timeline for d1a4cb_:

• d1a4cb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a4cb_ appears in SCOPe 2.01
  
• d1a4cb_ appears in SCOPe 2.03
  
• d1a4cb_ appears in the current release, SCOPe 2.08