SCOPe 2.05: Domain d4lp8a2: 4lp8 A:139-299

Lineage for d4lp8a2 (4lp8 A:139-299)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (4 PDB entries)

8. Domain d4lp8a2: 4lp8 A:139-299 [229113]
   Other proteins in same PDB: d4lp8a1
   automated match to d1xl4a1
   complexed with cl, k, peg

Details for d4lp8a2

PDB Entry: 4lp8, 2.46 Å

PDB Description: A Novel Open-State Crystal Structure of the Prokaryotic Inward Rectifier KirBac3.1

PDB Compounds: (A:) Inward rectifier potassium channel Kirbac3.1

SCOPe Domain Sequences for d4lp8a2:

Sequence; same for both SEQRES and ATOM records:

>d4lp8a2 b.1.18.16 (A:139-299) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrlpifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh

Timeline for d4lp8a2:

• d4lp8a2 first appeared in SCOPe 2.03
  
• d4lp8a2 appears in SCOPe 2.04
  
• d4lp8a2 appears in SCOPe 2.06
  
• d4lp8a2 appears in the current release, SCOPe 2.08