Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (24 families) |
Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48402] (19 PDB entries) |
Domain d4hvba3: 4hvb A:525-725 [229091] Other proteins in same PDB: d4hvba1, d4hvba2, d4hvba4 automated match to d1e8ya1 complexed with 19p |
PDB Entry: 4hvb (more details), 2.35 Å
SCOPe Domain Sequences for d4hvba3:
Sequence, based on SEQRES records: (download)
>d4hvba3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d4hvba3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea ylrgcg
Timeline for d4hvba3: