Lineage for d4m2pa_ (4m2p A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1734252Protein Recoverin [47533] (1 species)
    Calcium-myristoyl switch; only one EF-hand is functional
  7. 1734253Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)
  8. 1734256Domain d4m2pa_: 4m2p A: [228972]
    automated match to d2d8na_
    complexed with ca; mutant

Details for d4m2pa_

PDB Entry: 4m2p (more details), 1.45 Å

PDB Description: Crystal structure of a non-myristoylated C39D recoverin mutant with one calcium ion bound to EF-hand 3
PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d4m2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m2pa_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
galskeileelqlntkfteeelsswyqsflkedpsgritrqefqtiyskffpeadpkaya
qhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleiv
taifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrli
qfepqkvkeklk

SCOPe Domain Coordinates for d4m2pa_:

Click to download the PDB-style file with coordinates for d4m2pa_.
(The format of our PDB-style files is described here.)

Timeline for d4m2pa_: