SCOPe 2.02: Domain d1f56b_: 1f56 B:

Lineage for d1f56b_ (1f56 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plantacyanin [49527] (2 species)
   basic blue protein

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [49529] (1 PDB entry)

8. Domain d1f56b_: 1f56 B: [22897]
   complexed with cu1, so4

Details for d1f56b_

PDB Entry: 1f56, 2.05 Å

PDB Description: spinach plantacyanin

PDB Compounds: (B:) plantacyanin

SCOPe Domain Sequences for d1f56b_:

Sequence; same for both SEQRES and ATOM records:

>d1f56b_ b.6.1.1 (B:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]}
avynigwsfnvngargksfragdvlvfkyikgqhnvvavngrgyascsaprgartyssgq
drikltrgqnyficsfpghcgggmkiainak

Timeline for d1f56b_:

• d1f56b_ first appeared (with stable ids) in SCOP 1.55
  
• d1f56b_ appears in SCOPe 2.01
  
• d1f56b_ appears in SCOPe 2.03
  
• d1f56b_ appears in the current release, SCOPe 2.08