SCOPe 2.07: Domain d4i01b2: 4i01 B:139-208

Lineage for d4i01b2 (4i01 B:139-208)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)

8. Domain d4i01b2: 4i01 B:139-208 [228651]
   Other proteins in same PDB: d4i01a1, d4i01b1
   automated match to d1hw5a1
   complexed with cmp; mutant

Details for d4i01b2

PDB Entry: 4i01, 2.3 Å

PDB Description: Structure of the mutant Catabolite gen activator protein V140L

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d4i01b2:

Sequence; same for both SEQRES and ATOM records:

>d4i01b2 a.4.5.0 (B:139-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dltgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d4i01b2:

• d4i01b2 first appeared in SCOPe 2.03
  
• d4i01b2 appears in SCOPe 2.06
  
• d4i01b2 appears in the current release, SCOPe 2.08