Lineage for d4i01a1 (4i01 A:6-138)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426017Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2426023Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2426174Protein automated matches [190352] (9 species)
    not a true protein
  7. 2426175Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries)
  8. 2426194Domain d4i01a1: 4i01 A:6-138 [228648]
    Other proteins in same PDB: d4i01a2, d4i01b2
    automated match to d1hw5a2
    complexed with cmp; mutant

Details for d4i01a1

PDB Entry: 4i01 (more details), 2.3 Å

PDB Description: Structure of the mutant Catabolite gen activator protein V140L
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d4i01a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i01a1 b.82.3.2 (A:6-138) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyl
nqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrl
qvtsekvgnlafl

SCOPe Domain Coordinates for d4i01a1:

Click to download the PDB-style file with coordinates for d4i01a1.
(The format of our PDB-style files is described here.)

Timeline for d4i01a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i01a2