SCOPe 2.03: Domain d4hm4a1: 4hm4 A:1-154

Lineage for d4hm4a1 (4hm4 A:1-154)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (3 species)

7. Species Pseudomonas sp. [TaxId:69011] [228594] (10 PDB entries)

8. Domain d4hm4a1: 4hm4 A:1-154 [228602]
   Other proteins in same PDB: d4hm4a2, d4hm4b_
   automated match to d1o7na1
   complexed with 16n, edo, fe, fes, so4

Details for d4hm4a1

PDB Entry: 4hm4, 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to indan

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase subunit alpha

SCOPe Domain Sequences for d4hm4a1:

Sequence; same for both SEQRES and ATOM records:

>d4hm4a1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 69011]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

Timeline for d4hm4a1:

• d4hm4a1 is new in SCOPe 2.03-stable
  
• d4hm4a1 appears in SCOPe 2.04
  
• d4hm4a1 appears in the current release, SCOPe 2.08