Lineage for d1eobb_ (1eob B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773641Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1773642Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1773851Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 1773852Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (13 PDB entries)
  8. 1773864Domain d1eobb_: 1eob B: [22829]
    Other proteins in same PDB: d1eoba_
    complexed with dhb, fe

Details for d1eobb_

PDB Entry: 1eob (more details), 2.2 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with 3,4-dihydroxybenzoate
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1eobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eobb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOPe Domain Coordinates for d1eobb_:

Click to download the PDB-style file with coordinates for d1eobb_.
(The format of our PDB-style files is described here.)

Timeline for d1eobb_: