SCOPe 2.03: Domain d4i9sa_: 4i9s A:

Lineage for d4i9sa_ (4i9s A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (21 PDB entries)

8. Domain d4i9sa_: 4i9s A: [228186]
   automated match to d3js1a_
   complexed with ret; mutant

Details for d4i9sa_

PDB Entry: 4i9s, 2.58 Å

PDB Description: crystal structure of the r111k:r132l:y134f:t54v:r59w mutant of the cellular retinoic acid binding protein type ii in complex with all-trans retinal at 2.58 angstrom resolution

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d4i9sa_:

Sequence; same for both SEQRES and ATOM records:

>d4i9sa_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikvsttvwt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtkeltndgeli
ltmtaddvvctlvfvre

Timeline for d4i9sa_:

• d4i9sa_ is new in SCOPe 2.03-stable
  
• d4i9sa_ appears in SCOPe 2.04
  
• d4i9sa_ appears in the current release, SCOPe 2.08