Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) zinc-binding motif |
Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins) automatically mapped to Pfam PF01085 |
Protein automated matches [190324] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [228020] (2 PDB entries) |
Domain d4c4ma_: 4c4m A: [228021] automated match to d1vhha_ complexed with act, ca, zn |
PDB Entry: 4c4m (more details), 1.74 Å
SCOPe Domain Sequences for d4c4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c4ma_ d.65.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlm tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky gmlarlaveagfdwvyyeskahihcsvkaensva
Timeline for d4c4ma_: