Lineage for d3pcjr_ (3pcj R:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773641Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1773642Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1773851Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 1773866Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 1773971Domain d3pcjr_: 3pcj R: [22795]
    Other proteins in same PDB: d3pcja_, d3pcjb_, d3pcjc_, d3pcjd_, d3pcje_, d3pcjf_
    complexed with bme, fe, ino

Details for d3pcjr_

PDB Entry: 3pcj (more details), 2.13 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 2-hydroxyisonicotinic acid n-oxide
PDB Compounds: (R:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcjr_:

Sequence, based on SEQRES records: (download)

>d3pcjr_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pcjr_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pcjr_:

Click to download the PDB-style file with coordinates for d3pcjr_.
(The format of our PDB-style files is described here.)

Timeline for d3pcjr_: