Lineage for d4lrsa1 (4lrs A:10-294)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573465Species Thermomonospora curvata [TaxId:471852] [227770] (2 PDB entries)
  8. 1573466Domain d4lrsa1: 4lrs A:10-294 [227771]
    Other proteins in same PDB: d4lrsa2
    automated match to d4jn6a1
    complexed with cl, for, gol, mg, nad, peg, pyr, so4

Details for d4lrsa1

PDB Entry: 4lrs (more details), 1.55 Å

PDB Description: Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
PDB Compounds: (A:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4lrsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lrsa1 c.1.10.0 (A:10-294) automated matches {Thermomonospora curvata [TaxId: 471852]}
aprvritdstlrdgshamahqfteeqvratvhaldaagvevievshgdglggssfnygfs
avdeidlvaaavdeavnakiavlllpgvgtvrdlkrahdagasvariathcteadvscqh
faaarelgmetvgflmlahrigpeelarqarimvdagaqcvyvvdsagalvlsdvqarvq
alvreigheaqvgfhghqnlslgvansvlayqngarqidgalcalgagagnspteilaat
ferlnietgvnvqaalaaaeevvrpylprlpwadraaivqgyagv

SCOPe Domain Coordinates for d4lrsa1:

Click to download the PDB-style file with coordinates for d4lrsa1.
(The format of our PDB-style files is described here.)

Timeline for d4lrsa1: