Lineage for d4jn6a1 (4jn6 A:4-288)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573363Species Mycobacterium tuberculosis [TaxId:1773] [226657] (1 PDB entry)
  8. 1573364Domain d4jn6a1: 4jn6 A:4-288 [223905]
    Other proteins in same PDB: d4jn6a2, d4jn6c2
    automated match to d1nvmc2
    complexed with mn, na, oxl

Details for d4jn6a1

PDB Entry: 4jn6 (more details), 1.93 Å

PDB Description: Crystal Structure of the Aldolase-Dehydrogenase Complex from Mycobacterium tuberculosis HRv37
PDB Compounds: (A:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4jn6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jn6a1 c.1.10.0 (A:4-288) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mwdvritdtslrdgshhkrhqftkdevgaivaaldaagvpvievthgdglggssfnygfs
ktpeqeliklaaatakeariaflmlpgvgtkddikeardnggsicriathcteadvsiqh
fglarelgletvgflmmahtiapeklaaqarimadagcqcvyvvdsagalvldgvadrvs
alvaelgedaqvgfhghenlglgvansvaavragakqidgscrrfgagagnapvealigv
fdkigvktgidffdiadaaedvvrpampaeclldrnalimgysgv

SCOPe Domain Coordinates for d4jn6a1:

Click to download the PDB-style file with coordinates for d4jn6a1.
(The format of our PDB-style files is described here.)

Timeline for d4jn6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jn6a2