Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [227724] (2 PDB entries) |
Domain d4ja2a_: 4ja2 A: [227725] automated match to d4h60a_ complexed with act, mg, so4; mutant |
PDB Entry: 4ja2 (more details), 1.79 Å
SCOPe Domain Sequences for d4ja2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ja2a_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]} skkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmdg ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln e
Timeline for d4ja2a_: