Lineage for d1vcbl_ (1vcb L:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10567Superfamily b.3.3: VHL [49468] (1 family) (S)
  5. 10568Family b.3.3.1: VHL [49469] (1 protein)
  6. 10569Protein VHL [49470] (1 species)
  7. 10570Species Human (Homo sapiens) [TaxId:9606] [49471] (1 PDB entry)
  8. 10574Domain d1vcbl_: 1vcb L: [22538]
    Other proteins in same PDB: d1vcba_, d1vcbb_, d1vcbd_, d1vcbe_, d1vcbg_, d1vcbh_, d1vcbj_, d1vcbk_

Details for d1vcbl_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure

SCOP Domain Sequences for d1vcbl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcbl_ b.3.3.1 (L:) VHL {Human (Homo sapiens)}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOP Domain Coordinates for d1vcbl_:

Click to download the PDB-style file with coordinates for d1vcbl_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbl_: