SCOPe 2.02: Domain d1qhoa2: 1qho A:577-686

Lineage for d1qhoa2 (1qho A:577-686)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49457] (2 PDB entries)

8. Domain d1qhoa2: 1qho A:577-686 [22513]
   Other proteins in same PDB: d1qhoa1, d1qhoa3, d1qhoa4
   complexed with abd, ca, mal, so4

Details for d1qhoa2

PDB Entry: 1qho, 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1qhoa2:

Sequence; same for both SEQRES and ATOM records:

>d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}
lsgtqtsvvftvksapptnlgdkiyltgnipelgnwstdtsgavnnaqgpllapnypdwf
yvfsvpagktiqfkffikradgtiqwengsnhvattptgatgnitvtwqn

Timeline for d1qhoa2:

• d1qhoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1qhoa2 appears in SCOPe 2.01
  
• d1qhoa2 appears in SCOPe 2.03
  
• d1qhoa2 appears in the current release, SCOPe 2.08