Class b: All beta proteins [48724] (119 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain [49452] (1 family) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries) |
Domain d1dtua2: 1dtu A:584-686 [22509] Other proteins in same PDB: d1dtua1, d1dtua3, d1dtua4 complexed with aci, ca, glc, gld; mutant |
PDB Entry: 1dtu (more details), 2.4 Å
SCOP Domain Sequences for d1dtua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtua2 b.3.1.1 (A:584-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains} gdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvp agktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp
Timeline for d1dtua2: