SCOP 1.73: Domain d1cgua2: 1cgu A:580-684

Lineage for d1cgua2 (1cgu A:580-684)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (2 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1cgua2: 1cgu A:580-684 [22507]
   Other proteins in same PDB: d1cgua1, d1cgua3, d1cgua4
   complexed with ca, glc; mutant

Details for d1cgua2

PDB Entry: 1cgu, 2.5 Å

PDB Description: catalytic center of cyclodextrin glycosyltransferase derived from x- ray structure analysis combined with site-directed mutagenesis

PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOP Domain Sequences for d1cgua2:

Sequence; same for both SEQRES and ATOM records:

>d1cgua2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

Timeline for d1cgua2:

• d1cgua2 first appeared (with stable ids) in SCOP 1.55, called d1cgu_2
  
• d1cgua2 was called d1cgu_2 in SCOP 1.71
  
• d1cgua2 appears in SCOP 1.75
  
• d1cgua2 appears in the current release, SCOPe 2.08