Lineage for d1cgu_2 (1cgu 580-684)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552997Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 552998Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) (S)
  5. 552999Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 553031Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 553032Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 553068Domain d1cgu_2: 1cgu 580-684 [22507]
    Other proteins in same PDB: d1cgu_1, d1cgu_3, d1cgu_4
    complexed with ca, glc; mutant

Details for d1cgu_2

PDB Entry: 1cgu (more details), 2.5 Å

PDB Description: catalytic center of cyclodextrin glycosyltransferase derived from x- ray structure analysis combined with site-directed mutagenesis

SCOP Domain Sequences for d1cgu_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgu_2 b.3.1.1 (580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

SCOP Domain Coordinates for d1cgu_2:

Click to download the PDB-style file with coordinates for d1cgu_2.
(The format of our PDB-style files is described here.)

Timeline for d1cgu_2: