Lineage for d4m7wc_ (4m7w C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2142019Species Leptotrichia buccalis [TaxId:523794] [224900] (1 PDB entry)
  8. 2142022Domain d4m7wc_: 4m7w C: [224835]
    automated match to d2iscf_
    complexed with po4

Details for d4m7wc_

PDB Entry: 4m7w (more details), 1.9 Å

PDB Description: Crystal structure of purine nucleoside phosphorylase from Leptotrichia buccalis C-1013-b, NYSGRC Target 029767.
PDB Compounds: (C:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4m7wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m7wc_ c.56.2.0 (C:) automated matches {Leptotrichia buccalis [TaxId: 523794]}
mgtphiganrgdvaetillpgdplrakyiaetfledvvqynnvrgmlgftgtykgkkvsv
qgtgmgvpsigiyshelitefgvknlirvgtagsyqedvkvrdvviamsastdsainklr
fngadyaptassdlvfkayeiakakglnvkagnvftsdtfygddpnawkkwaefgvlcve
metaqlyttaaklgvnaltlltisdsfithevtsaeerqttfnemievaletalql

SCOPe Domain Coordinates for d4m7wc_:

Click to download the PDB-style file with coordinates for d4m7wc_.
(The format of our PDB-style files is described here.)

Timeline for d4m7wc_: